PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_40103
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family NAC
Protein Properties Length: 150aa    MW: 17339 Da    PI: 9.7032
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_40103genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.14.1e-5451301128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhP+deel+++yL++kv++ ++   ++i++vd++k+ePwdLp k++ +ek  yfFs +d+ky+tg r+nrat++gyWk+tgkdke+++  g l
  PEQU_40103   5 LPPGFRFHPSDEELITYYLTRKVSDFEFVS-KAISDVDLNKCEPWDLPGKASLGEKVGYFFSLKDRKYPTGMRTNRATNAGYWKTTGKDKEIFH-YGVL 101
                 79*************************988.88***************8888888999************************************.999* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                 vg+kktLvfykgrapkgekt+Wvmheyrl
  PEQU_40103 102 VGMKKTLVFYKGRAPKGEKTSWVMHEYRL 130
                 ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-583137IPR003441NAC domain
PROSITE profilePS5100551.6995148IPR003441NAC domain
PfamPF023654.0E-286130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MEEGLPPGFR FHPSDEELIT YYLTRKVSDF EFVSKAISDV DLNKCEPWDL PGKASLGEKV  60
GYFFSLKDRK YPTGMRTNRA TNAGYWKTTG KDKEIFHYGV LVGMKKTLVF YKGRAPKGEK  120
TSWVMHEYRL QTDFPYKPSK VLILLSYLSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-50513020145NAC domain-containing protein 19
3swm_B6e-50513020145NAC domain-containing protein 19
3swm_C6e-50513020145NAC domain-containing protein 19
3swm_D6e-50513020145NAC domain-containing protein 19
3swp_A6e-50513020145NAC domain-containing protein 19
3swp_B6e-50513020145NAC domain-containing protein 19
3swp_C6e-50513020145NAC domain-containing protein 19
3swp_D6e-50513020145NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010916375.12e-88PREDICTED: NAC domain-containing protein 100
SwissprotO040173e-69NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLA0A060CXK95e-88A0A060CXK9_MAIZE; NAC transcription factor (Fragment)
STRINGGRMZM2G031120_P011e-87(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-82NAC domain containing protein 58